HPA005741

SELENBP1 antibody from Sigma-Aldrich
hSBP, hSP56, LPSB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005741
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005741, RRID:AB_1856662
Product name
Anti-SELENBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005741
Antibody type
Polyclonal
Antigen
Selenium-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVK
GNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFW
YQPRHNVMISTEWAAPNVLRDGFNPADV
Storage
-20C
Provider Type Product Number
- No reagents -