Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005977-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005977-M01, RRID:AB_463876
- Product name
- DPF2 monoclonal antibody (M01), clone 2F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DPF2.
- Antigen sequence
WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPED
PRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRT
DPLEKRGAPDPRVDDDSLGEFPVTNSRARK- Isotype
- IgG
- Antibody clone number
- 2F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transient and etiology-related transcription regulation in cirrhosis prior to hepatocellular carcinoma occurrence.
Caillot F, Derambure C, Bioulac-Sage P, Francois A, Scotte M, Goria O, Hiron M, Daveau M, Salier JP
World journal of gastroenterology 2009 Jan 21;15(3):300-9
World journal of gastroenterology 2009 Jan 21;15(3):300-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DPF2 monoclonal antibody (M01), clone 2F6 Western Blot analysis of DPF2 expression in LNCaP ( Cat # L004V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody (M01), clone 2F6.Lane 1: DPF2 transfected lysate(44 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol