Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024082 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TMEM45A
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FITWLVKSRLKRLCSSEVGLLKNAEREQESEEE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Characterization of the role of TMEM45A in cancer cell sensitivity to cisplatin
TMEM45A is essential for hypoxia-induced chemoresistance in breast and liver cancer cells
Schmit K, Chen J, Ayama-Canden S, Fransolet M, Finet L, Demazy C, D’Hondt L, Graux C, Michiels C
Cell Death & Disease 2019;10(12)
Cell Death & Disease 2019;10(12)
TMEM45A is essential for hypoxia-induced chemoresistance in breast and liver cancer cells
Flamant L, Roegiers E, Pierre M, Hayez A, Sterpin C, De Backer O, Arnould T, Poumay Y, Michiels C
BMC Cancer 2012;12(1)
BMC Cancer 2012;12(1)
No comments: Submit comment
No validations: Submit validation data