PAB21643

TMEM45A antibody from Abnova Corporation
DERP7, FLJ10134

Antibody data

Product number
PAB21643
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21643, RRID:AB_10968516
Product name
TMEM45A polyclonal antibody
Provider product page
Abnova Corporation - PAB21643
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human TMEM45A.
Reactivity
Human
Host
Rabbit
Antigen sequence
FITWLVKSRLKRLCSSEVGLLKNAEREQESEEE
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -