Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003418-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003418-M01, RRID:AB_606433
- Product name
- IDH2 monoclonal antibody (M01), clone 5F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IDH2.
- Antigen sequence
HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGN
QDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLS
NVKLNEHFLNTTDFLDTIKSNLDRALGR- Isotype
- IgG
- Antibody clone number
- 5F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decreased expression of ten-eleven translocation 2 protein is associated with progressive disease and death in patients with mycosis fungoides.
Altered global methylation and hydroxymethylation status in vulvar lichen sclerosus: further support for epigenetic mechanisms.
Gambichler T, Mamali K, Patsinakidis N, Moritz R, Mucke M, Skrygan M, Stockfleth E, Stücker M
The British journal of dermatology 2016 Mar;174(3):652-3
The British journal of dermatology 2016 Mar;174(3):652-3
Altered global methylation and hydroxymethylation status in vulvar lichen sclerosus: further support for epigenetic mechanisms.
Gambichler T, Terras S, Kreuter A, Skrygan M
The British journal of dermatology 2014 Mar;170(3):687-93
The British journal of dermatology 2014 Mar;170(3):687-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody (M01), clone 5F11.Lane 1: IDH2 transfected lysate(50.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IDH2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol