Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007831 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007831, RRID:AB_1851397
- Product name
- Anti-IDH2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REPIICKNIPRLVPGWTKPITIGRHAHGDQYKATD
FVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVG
MGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNT
ILKAYDGRFKDIFQEIFDKHYKTDFD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references S1P Released by SGPL1-Deficient Astrocytes Enhances Astrocytic ATP Production via S1PR2,4, Thus Keeping Autophagy in Check: Potential Consequences for Brain Health
Succinate mediates inflammation-induced adrenocortical dysfunction
Induced pluripotent stem cell-derived cells model brain microvascular endothelial cell glucose metabolism
Sphingosine‐1‐phosphate‐lyase deficiency affects glucose metabolism in a way that abets oncogenesis
Operation of a TCA cycle subnetwork in the mammalian nucleus.
Protein profile of fiber types in human skeletal muscle: a single-fiber proteomics study.
Single muscle fiber proteomics reveals unexpected mitochondrial specialization
Alam S, Afsar S, Van Echten-Deckert G
International Journal of Molecular Sciences 2023;24(5):4581
International Journal of Molecular Sciences 2023;24(5):4581
Succinate mediates inflammation-induced adrenocortical dysfunction
Mateska I, Witt A, Hagag E, Sinha A, Yilmaz C, Thanou E, Sun N, Kolliniati O, Patschin M, Abdelmegeed H, Henneicke H, Kanczkowski W, Wielockx B, Tsatsanis C, Dahl A, Walch A, Li K, Peitzsch M, Chavakis T, Alexaki V
eLife 2023;12
eLife 2023;12
Induced pluripotent stem cell-derived cells model brain microvascular endothelial cell glucose metabolism
Weber C, Moiz B, Zic S, Alpízar Vargas V, Li A, Clyne A
Fluids and Barriers of the CNS 2022;19(1)
Fluids and Barriers of the CNS 2022;19(1)
Sphingosine‐1‐phosphate‐lyase deficiency affects glucose metabolism in a way that abets oncogenesis
Afsar S, Alam S, Fernandez Gonzalez C, van Echten‐Deckert G
Molecular Oncology 2022;16(20):3642-3653
Molecular Oncology 2022;16(20):3642-3653
Operation of a TCA cycle subnetwork in the mammalian nucleus.
Kafkia E, Andres-Pons A, Ganter K, Seiler M, Smith TS, Andrejeva A, Jouhten P, Pereira F, Franco C, Kuroshchenkova A, Leone S, Sawarkar R, Boston R, Thaventhiran J, Zaugg JB, Lilley KS, Lancrin C, Beck M, Patil KR
Science advances 2022 Sep 2;8(35):eabq5206
Science advances 2022 Sep 2;8(35):eabq5206
Protein profile of fiber types in human skeletal muscle: a single-fiber proteomics study.
Murgia M, Nogara L, Baraldo M, Reggiani C, Mann M, Schiaffino S
Skeletal muscle 2021 Nov 2;11(1):24
Skeletal muscle 2021 Nov 2;11(1):24
Single muscle fiber proteomics reveals unexpected mitochondrial specialization
Murgia M, Nagaraj N, Deshmukh A, Zeiler M, Cancellara P, Moretti I, Reggiani C, Schiaffino S, Mann M
EMBO reports 2015;16(3):387-395
EMBO reports 2015;16(3):387-395
No comments: Submit comment
No validations: Submit validation data