HPA005566

AMT antibody from Sigma-Aldrich
GCST, NKH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005566
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005566, RRID:AB_1844811
Product name
Anti-AMT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005566
Antibody type
Polyclonal
Antigen
Aminomethyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDR
VKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDD
LIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQ
NQGRDVGLEVLDNALL
Storage
-20C
Provider Type Product Number
- No reagents -