HPA014848

PON3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014848
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014848, RRID:AB_1855540
Product name
Anti-PON3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014848
Antibody type
Polyclonal
Antigen
Serum paraoxonase/lactonase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REVEPVEPENCHLIEELESGSEDIDILPSGLAFIS
SGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALE
ISGGFDKELFNPHGISIFIDKDNTVYLYVVNHP
Storage
-20C
Provider Type Product Number
- No reagents -