HPA052206

TFG antibody from Atlas Antibodies
FLJ36137, SPG57, TF6

Antibody data

Product number
HPA052206
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052206, RRID:AB_2681760
Product name
Anti-TFG
Provider product page
Atlas Antibodies - HPA052206
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPEND
TVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQ
DEINKNVMSAFGLTDDQVSGPPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -