HPA052206

TFG antibody from Atlas Antibodies
FLJ36137, SPG57, TF6

Antibody data

Product number
HPA052206
Provider
Atlas Antibodies
Product name
Anti-TFG
Provider product page
Atlas Antibodies - HPA052206
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPEND
TVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQ
DEINKNVMSAFGLTDDQVSGPPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -