Antibody data

Product number
H00023576-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023576-M01, RRID:AB_1204253
Product name
DDAH1 monoclonal antibody (M01), clone 3F7
Provider product page
Abnova Corporation - H00023576-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DDAH1.
Antigen sequence
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVP
DDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYE
KLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
Isotype
IgG
Antibody clone number
3F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -