Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406440 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGL
SKRTN QRGAEILADT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references No association of the genetic polymorphisms of endothelial nitric oxide synthase, dimethylarginine dimethylaminohydrolase, and vascular endothelial growth factor with preeclampsia in Korean populations.
Management of intrathecal catheter-tip inflammatory masses: an updated 2007 consensus statement from an expert panel.
Kim YJ, Park BH, Park H, Jung SC, Pang MG, Ryu HM, Lee KS, Eom SM, Park HY
Twin research and human genetics : the official journal of the International Society for Twin Studies 2008 Feb;11(1):77-83
Twin research and human genetics : the official journal of the International Society for Twin Studies 2008 Feb;11(1):77-83
Management of intrathecal catheter-tip inflammatory masses: an updated 2007 consensus statement from an expert panel.
Deer T, Krames ES, Hassenbusch S, Burton A, Caraway D, Dupen S, Eisenach J, Erdek M, Grigsby E, Kim P, Levy R, McDowell G, Mekhail N, Panchal S, Prager J, Rauck R, Saulino M, Sitzman T, Staats P, Stanton-Hicks M, Stearns L, Dean Willis K, Witt W, Follett K, Huntoon M, Liem L, Rathmell J, Wallace M, Buchser E, Cousins M, Ver Donck A
Neuromodulation : journal of the International Neuromodulation Society 2008 Apr;11(2):77-91
Neuromodulation : journal of the International Neuromodulation Society 2008 Apr;11(2):77-91
No comments: Submit comment
No validations: Submit validation data