Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006308 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006308, RRID:AB_1847532
- Product name
- Anti-DDAH1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSF
CSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKL
TVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAK
VYEKLKDHMLIPVSMSELEKVDGLLT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Pulmonary hypertension associated with advanced systolic heart failure: dysregulated arginine metabolism and importance of compensatory dimethylarginine dimethylaminohydrolase-1.
Shao Z, Wang Z, Shrestha K, Thakur A, Borowski AG, Sweet W, Thomas JD, Moravec CS, Hazen SL, Tang WH
Journal of the American College of Cardiology 2012 Mar 27;59(13):1150-8
Journal of the American College of Cardiology 2012 Mar 27;59(13):1150-8
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and skin tissues using Anti-DDAH1 antibody. Corresponding DDAH1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN