HPA006308

DDAH1 antibody from Sigma-Aldrich
DDAH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006308
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006308, RRID:AB_1847532
Product name
Anti-DDAH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006308
Antibody type
Polyclonal
Antigen
N recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSF
CSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKL
TVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAK
VYEKLKDHMLIPVSMSELEKVDGLLT
Storage
-20C
Provider Type Product Number
- No reagents -