Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007222-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007222-A01, RRID:AB_462874
- Product name
- TRPC3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TRPC3.
- Antigen sequence
TARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEI
QYFTYARDKWLPSDPQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Abnormal expression, localization and interaction of canonical transient receptor potential ion channels in human breast cancer cell lines and tissues: a potential target for breast cancer diagnosis and therapy.
Aydar E, Yeo S, Djamgoz M, Palmer C
Cancer cell international 2009 Aug 18;9:23
Cancer cell international 2009 Aug 18;9:23
No comments: Submit comment
No validations: Submit validation data