Antibody data

Product number
ABIN504516
Provider
antibodies-online
Product name
anti-Transient Receptor Potential Cation Channel, Subfamily C, Member 3 (TRPC3) (N-Term) antibody
Provider product page
antibodies-online - ABIN504516
Antibody type
Polyclonal
Antigen
The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTS
LTAEE ERFLDAAEYG
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -