HPA012669

UBXN1 antibody from Sigma-Aldrich
2B28, LOC51035, SAKS1, UBXD10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012669
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012669, RRID:AB_1853149
Product name
Anti-UBXN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012669
Antibody type
Polyclonal
Antigen
UBX domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAA
MDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG
GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQK
QREREEREEREALERERQRRRQGQELSAARQRLQE
DEMRRAAEER
Storage
-20C
Provider Type Product Number
- No reagents -