HPA012127

LBHD1 antibody from Sigma-Aldrich
C11orf48, MGC2477
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012127
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012127, RRID:AB_1845527
Product name
Anti-C11orf48 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012127
Antibody type
Polyclonal
Antigen
hypothetical protein LOC79081 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDR
GKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNEES
GDLHLPHEELLLLTDGEEEDAEAFFQDQSE
Storage
-20C
Provider Type Product Number
- No reagents -