Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182963 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chaperonin Containing TCP1, Subunit 4 (Delta) (CCT4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCT4 antibody: synthetic peptide directed towards the C terminal of human CCT4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQG
EKTAG INVRKGGISN- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DYX1C1 is required for axonemal dynein assembly and ciliary motility.
Functional interactions of human immunodeficiency virus type 1 integrase with human and yeast HSP60.
Tarkar A, Loges NT, Slagle CE, Francis R, Dougherty GW, Tamayo JV, Shook B, Cantino M, Schwartz D, Jahnke C, Olbrich H, Werner C, Raidt J, Pennekamp P, Abouhamed M, Hjeij R, Köhler G, Griese M, Li Y, Lemke K, Klena N, Liu X, Gabriel G, Tobita K, Jaspers M, Morgan LC, Shapiro AJ, Letteboer SJ, Mans DA, Carson JL, Leigh MW, Wolf WE, Chen S, Lucas JS, Onoufriadis A, Plagnol V, Schmidts M, Boldt K, UK10K, Roepman R, Zariwala MA, Lo CW, Mitchison HM, Knowles MR, Burdine RD, Loturco JJ, Omran H
Nature genetics 2013 Sep;45(9):995-1003
Nature genetics 2013 Sep;45(9):995-1003
Functional interactions of human immunodeficiency virus type 1 integrase with human and yeast HSP60.
Parissi V, Calmels C, De Soultrait VR, Caumont A, Fournier M, Chaignepain S, Litvak S
Journal of virology 2001 Dec;75(23):11344-53
Journal of virology 2001 Dec;75(23):11344-53
No comments: Submit comment
No validations: Submit validation data