Antibody data

Product number
ABIN504622
Provider
antibodies-online
Product name
anti-Serotonin Receptor 4 (HTR4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504622
Antibody type
Polyclonal
Antigen
The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQN
SNSTY CVFMVNKPYA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -