HPA012012

PIGR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012012, RRID:AB_1855371
Product name
Anti-PIGR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012012
Antibody type
Polyclonal
Antigen
Polymeric immunoglobulin receptor Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADL
QVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFL
CRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKD
GSFSVVITGLRKEDAGRYLCGAHS
Storage
-20C
Provider Type Product Number
- No reagents -