HPA024138

ZBTB11 antibody from Sigma-Aldrich
ZNF-U69274, ZNF913
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024138, RRID:AB_1858939
Product name
Anti-ZBTB11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024138
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGMGNDISAEDICAEDIPKHRQKVDQPLKDQENLV
ASTAKTDFGPDDDTYRSRLRQRSVNEGAYIRLHKG
MEKKLQKRKAVPKSAVQQVAQKLVQRGKKMKQPKR
DAKENTEEASH
Storage
-20C
Provider Type Product Number
- No reagents -