HPA015328

ZBTB11 antibody from Atlas Antibodies
ZNF-U69274, ZNF913
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015328
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015328, RRID:AB_1858938
Product name
Anti-ZBTB11
Provider product page
Atlas Antibodies - HPA015328
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSL
PTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVS
SEAESALSSVGCIADSHPEMESVDLITKNNQTELE
TSNNRENNTVSNIHPKLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -