Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309716 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chymotrypsin (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQ
VLSVS RAITHPSWNS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mast cell chymase degrades apoE and apoA-II in apoA-I-knockout mouse plasma and reduces its ability to promote cellular cholesterol efflux.
Mast cell tryptase degrades HDL and blocks its function as an acceptor of cellular cholesterol.
Lee M, Calabresi L, Chiesa G, Franceschini G, Kovanen PT
Arteriosclerosis, thrombosis, and vascular biology 2002 Sep 1;22(9):1475-81
Arteriosclerosis, thrombosis, and vascular biology 2002 Sep 1;22(9):1475-81
Mast cell tryptase degrades HDL and blocks its function as an acceptor of cellular cholesterol.
Lee M, Sommerhoff CP, von Eckardstein A, Zettl F, Fritz H, Kovanen PT
Arteriosclerosis, thrombosis, and vascular biology 2002 Dec 1;22(12):2086-91
Arteriosclerosis, thrombosis, and vascular biology 2002 Dec 1;22(12):2086-91
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting