HPA005753

PBK antibody from Sigma-Aldrich
CT84, FLJ14385, Nori-3, SPK, TOPK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005753, RRID:AB_1855018
Product name
Anti-PBK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005753
Antibody type
Polyclonal
Antigen
Lymphokine-activated killer T-cell-originated protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEA
CYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWE
MMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAA
LGTRPPINMEELDESYQKVIELFSVCTNEDPKDRP
Storage
-20C
Provider Type Product Number
- No reagents -