Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002980 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002980, RRID:AB_1848820
- Product name
- Anti-CEP97
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPP
ISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAP
QEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSST
EGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics
Cao J, Shen Y, Zhu L, Xu Y, Zhou Y, Wu Z, Li Y, Yan X, Zhu X
Nature Cell Biology 2012 June;14(7):697-706
Nature Cell Biology 2012 June;14(7):697-706
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubule organizing center.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and pancreas tissues using Anti-CEP97 antibody. Corresponding CEP97 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN