HPA002980

CEP97 antibody from Sigma-Aldrich
FLJ23047, LRRIQ2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002980, RRID:AB_1848820
Product name
Anti-CEP97 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002980
Antibody type
Polyclonal
Antigen
Centrosomal protein of 97 kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPP
ISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAP
QEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSST
EGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN
Storage
-20C
Provider Type Product Number
- No reagents -