HPA003431

ADRB2 antibody from Sigma-Aldrich
ADRB2R, ADRBR, B2AR, BAR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003431
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003431, RRID:AB_1845333
Product name
Anti-ADRB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003431
Antibody type
Polyclonal
Antigen
Beta-2 adrenergic receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTG
EQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPS
DNIDSQGRNCSTNDSLL
Storage
-20C
Provider Type Product Number
- No reagents -