Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501450 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phospholipase A2, Group IVB Cytosolic (PLA2G4B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTP
ATYQL TEEGTFKVVD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the expressed form of human cytosolic phospholipase A2beta (cPLA2beta): cPLA2beta3 is a novel variant localized to mitochondria and early endosomes.
Ghosh M, Loper R, Gelb MH, Leslie CC
The Journal of biological chemistry 2006 Jun 16;281(24):16615-24
The Journal of biological chemistry 2006 Jun 16;281(24):16615-24
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting