Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487172 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lecithin-Cholesterol Acyltransferase (LCAT) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPL
HGIQH LNMVFSNLTL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Therapeutic management of a new case of LCAT deficiency with a multifactorial long-term approach based on high doses of angiotensin II receptor blockers (ARBs).
Aranda P, Valdivielso P, Pisciotta L, Garcia I, Garcã A-Arias C, Bertolini S, Martã N-Reyes G, Gonzã Lez-Santos, Calandra S
Clinical nephrology 2008 Mar;69(3):213-8
Clinical nephrology 2008 Mar;69(3):213-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry