HPA026419

RAB14 antibody from Atlas Antibodies
FBP, RAB-14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026419
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026419, RRID:AB_1855996
Product name
Anti-RAB14
Provider product page
Atlas Antibodies - HPA026419
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLS
SWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE
AKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY
QNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQP
Q
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -