Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011155-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011155-M06, RRID:AB_606499
- Product name
- LDB3 monoclonal antibody (M06), clone 3C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant LDB3.
- Antigen sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPG
SKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIK
SASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPH
QKVVVNSPANADYQERFNPSALKDSALSTHKPIEV
KGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQ
AQGSDFSGSLPIKDLAVDSASPVYQAVIKSQNKPE
DEADEWARRSSNLQSRSFRILAQMTGTEFMQDPDE
EALRRSRERFETERNSPRFAKLRNWHHGLSAQILN
VKS- Isotype
- IgG
- Antibody clone number
- 3C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Z-disc-associated, alternatively spliced, PDZ motif-containing protein (ZASP) mutations in the actin-binding domain cause disruption of skeletal muscle actin filaments in myofibrillar myopathy.
Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated cardiomyopathy.
Lin X, Ruiz J, Bajraktari I, Ohman R, Banerjee S, Gribble K, Kaufman JD, Wingfield PT, Griggs RC, Fischbeck KH, Mankodi A
The Journal of biological chemistry 2014 May 9;289(19):13615-26
The Journal of biological chemistry 2014 May 9;289(19):13615-26
Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated cardiomyopathy.
Arimura T, Inagaki N, Hayashi T, Shichi D, Sato A, Hinohara K, Vatta M, Towbin JA, Chikamori T, Yamashina A, Kimura A
Cardiovascular research 2009 Jul 1;83(1):80-8
Cardiovascular research 2009 Jul 1;83(1):80-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LDB3 monoclonal antibody (M06), clone 3C8 Western Blot analysis of LDB3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LDB3 expression in transfected 293T cell line by LDB3 monoclonal antibody (M06), clone 3C8.Lane 1: LDB3 transfected lysate(31 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LDB3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LDB3 on A-431 cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol