HPA008741

AGFG1 antibody from Sigma-Aldrich
HRB, RAB, RIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008741
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008741, RRID:AB_1850752
Product name
Anti-AGFG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008741
Antibody type
Polyclonal
Antigen
Arf-GAP domain and FG repeats-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQSTATANFANFAHFNSHAAQNSANADFANFDAFG
QSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANF
AHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTN
KAGLQTADKYAALANLDNIFSAG
Storage
-20C
Provider Type Product Number
- No reagents -