HPA005755

PDZK1 antibody from Sigma-Aldrich
NHERF3, PDZD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005755, RRID:AB_1855164
Product name
Anti-PDZK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005755
Antibody type
Polyclonal
Antigen
PDZ domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQ
KIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLR
AGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNG
ESVET
Storage
-20C
Provider Type Product Number
- No reagents -