Antibody data

Product number
PAB20988
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20988, RRID:AB_10963206
Product name
SLC30A2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20988
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human SLC30A2.
Reactivity
Human
Host
Rabbit
Antigen sequence
VLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWA
LTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKF
HFHTVTIQIEDYSEDMKDCQACQGPSD
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -