HPA017979

SLC30A2 antibody from Sigma-Aldrich
ZNT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017979, RRID:AB_1857085
Product name
Anti-SLC30A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017979
Antibody type
Polyclonal
Antigen
Zinc transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWA
LTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKF
HFHTVTIQIEDYSEDMKDCQACQGPSD
Storage
-20C
Provider Type Product Number
- No reagents -