HPA017979

SLC30A2 antibody from Atlas Antibodies
ZNT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017979, RRID:AB_1857085
Product name
Anti-SLC30A2
Provider product page
Atlas Antibodies - HPA017979
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWA
LTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKF
HFHTVTIQIEDYSEDMKDCQACQGPSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -