Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057381-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057381-M01, RRID:AB_426036
- Product name
- RHOJ monoclonal antibody (M01), clone 1E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RHOJ.
- Antigen sequence
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKT
CLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNP
ASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLEC
SALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
CSII- Isotype
- IgG
- Antibody clone number
- 1E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references RhoJ regulates melanoma chemoresistance by suppressing pathways that sense DNA damage.
Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice.
Ho H, Aruri J, Kapadia R, Mehr H, White MA, Ganesan AK
Cancer research 2012 Nov 1;72(21):5516-28
Cancer research 2012 Nov 1;72(21):5516-28
Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice.
Fukushima Y, Okada M, Kataoka H, Hirashima M, Yoshida Y, Mann F, Gomi F, Nishida K, Nishikawa S, Uemura A
The Journal of clinical investigation 2011 May;121(5):1974-85
The Journal of clinical investigation 2011 May;121(5):1974-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RHOJ is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RHOJ on HeLa cell. [antibody concentration 60 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol