HPA003050

RHOJ antibody from Sigma-Aldrich
ARHJ, FLJ14445, RASL7B, TCL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003050
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003050, RRID:AB_1079812
Product name
Anti-RHOJ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003050
Antibody type
Polyclonal
Antigen
ρ-Related GTP-binding protein RhoJ precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGT
QIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIG
AQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKR
CSEG
Storage
-20C
Provider Type Product Number
- No reagents -