HPA007830

MRPS22 antibody from Atlas Antibodies
C3orf5, GIBT, GK002, MRP-S22
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007830
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007830, RRID:AB_1854123
Product name
Anti-MRPS22
Provider product page
Atlas Antibodies - HPA007830
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHV
DVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYD
LLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLID
DATNLVQLYHVLHPDGQSAQGAKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -