HPA007830

MRPS22 antibody from Sigma-Aldrich
C3orf5, GIBT, GK002, MRP-S22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007830, RRID:AB_1854123
Product name
Anti-MRPS22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007830
Antibody type
Polyclonal
Antigen
28S ribosomal protein S22, mitochondrial recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHV
DVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYD
LLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLID
DATNLVQLYHVLHPDGQSAQGAKD
Storage
-20C
Provider Type Product Number
- No reagents -