HPA019484

BAIAP2L1 antibody from Atlas Antibodies
IRTKS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019484
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019484, RRID:AB_1845265
Product name
Anti-BAIAP2L1
Provider product page
Atlas Antibodies - HPA019484
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLID
MFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVAT
GLNMMKKQKVKTIFPHTAGSN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -