HPA021257

BAIAP2L1 antibody from Sigma-Aldrich
IRTKS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021257
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021257, RRID:AB_1845266
Product name
Anti-BAIAP2L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021257
Antibody type
Polyclonal
Antigen
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWF
PSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLS
EN
Storage
-20C
Provider Type Product Number
- No reagents -