HPA006353

SCUBE2 antibody from Sigma-Aldrich
Cegb1, Cegf1, FLJ16792
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006353
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006353, RRID:AB_1856642
Product name
Anti-SCUBE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006353
Antibody type
Polyclonal
Antigen
Signal peptide, CUB and EGF-like domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESCGVGQGHAENQCVSCRAGTYYDGARERCILCPN
GTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSEC
GGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSC
Storage
-20C
Provider Type Product Number
- No reagents -