HPA029871

SCUBE2 antibody from MilliporeSigma / Merck KGaA
Cegb1, Cegf1, FLJ16792
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029871
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029871, RRID:AB_10602299
Product name
Anti-SCUBE2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029871
Antibody type
Polyclonal
Antigen
signal peptide, CUB domain, EGF-like 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGIHLSSDVTTIRTSVTFKLNEGKCSLKNAELFPE
GLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPG
RPSTPKEMFITVEFELETNQKEVTASCDLSCIVKR
TEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAK
Storage
-20C
Provider Type Product Number
- No reagents -