Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310170 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hydroxysteroid (17-Beta) Dehydrogenase 6 Homolog (Mouse) (HSD17B6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HSD17B6 antibody: synthetic peptide directed towards the N terminal of human HSD17B6
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFIT
GCDSG FGNLLARQLD- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Activation of the androgen receptor by intratumoral bioconversion of androstanediol to dihydrotestosterone in prostate cancer.
Estrogen receptor β and 17β-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer.
Gene structure, chromosomal localization and analysis of 3-ketosteroid reductase activity of the human 3(alpha-->beta)-hydroxysteroid epimerase.
Mohler JL, Titus MA, Bai S, Kennerley BJ, Lih FB, Tomer KB, Wilson EM
Cancer research 2011 Feb 15;71(4):1486-96
Cancer research 2011 Feb 15;71(4):1486-96
Estrogen receptor β and 17β-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer.
Muthusamy S, Andersson S, Kim HJ, Butler R, Waage L, Bergerheim U, Gustafsson JÅ
Proceedings of the National Academy of Sciences of the United States of America 2011 Dec 13;108(50):20090-4
Proceedings of the National Academy of Sciences of the United States of America 2011 Dec 13;108(50):20090-4
Gene structure, chromosomal localization and analysis of 3-ketosteroid reductase activity of the human 3(alpha-->beta)-hydroxysteroid epimerase.
Huang XF, Luu-The V
Biochimica et biophysica acta 2001 Aug 30;1520(2):124-30
Biochimica et biophysica acta 2001 Aug 30;1520(2):124-30
No comments: Submit comment
No validations: Submit validation data