HPA012016

ERBB4 antibody from Atlas Antibodies
ALS19, HER4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012016
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012016, RRID:AB_1846541
Product name
Anti-ERBB4
Provider product page
Atlas Antibodies - HPA012016
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFN
IPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -