Antibody data

Product number
ABIN502666
Provider
antibodies-online
Product name
anti-Glutamate Dehydrogenase 1 (GLUD1) antibody
Provider product page
antibodies-online - ABIN502666
Antibody type
Polyclonal
Antigen
The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian
Host
Rabbit
Antigen sequence
AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIG
PGIDV PAPDMSTGER
Vial size
50 µg
Provider Type Product Number
- No reagents -