HPA027037

GPR182 antibody from Sigma-Aldrich
ADMR, AM-R, G10D, hrhAMR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027037
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027037, RRID:AB_1844622
Product name
Anti-GPR182 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027037
Antibody type
Polyclonal
Antigen
G-protein coupled receptor 182 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCST
QHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNT
SPISPTQPLTPS
Storage
-20C
Provider Type Product Number
- No reagents -