HPA005853

TRAK1 antibody from Atlas Antibodies
KIAA1042, MILT1, OIP106
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005853
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005853, RRID:AB_1854778
Product name
Anti-TRAK1
Provider product page
Atlas Antibodies - HPA005853
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRR
YHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDIT
HQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSS
AMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSII
LET
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -