HPA005853

TRAK1 antibody from Sigma-Aldrich
KIAA1042, MILT1, OIP106
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005853, RRID:AB_1854778
Product name
Anti-TRAK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005853
Antibody type
Polyclonal
Antigen
Trafficking kinesin-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRR
YHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDIT
HQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSS
AMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSII
LET
Storage
-20C
Provider Type Product Number
- No reagents -